SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K7EIG3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K7EIG3
Sequence length 197
Comment (tr|K7EIG3|K7EIG3_HUMAN) Palmitoleoyl-protein carboxylesterase NOTUM {ECO:0000313|Ensembl:ENSP00000464734} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=NOTUM OC=Catarrhini; Hominidae; Homo.
Sequence
MRRLMSSRDWPRTRTGTGILSSQPEENPYWWNANMVFIPYCSSDVWSGASSKSEKNEYAF
MGALIIQEVVRELLGRGLSGAKVLLLAGSSAGGTGVLLNVDRVAEQLEKLGYPAIQVRGL
ADSGWFLDNKQYRHTDCVDTITCAPTEAIRRGIRYWNGVVPERCRRQFQEGEEWNCFFGY
KVYPTLRCPVFVVQWLF
Download sequence
Identical sequences K7EIG3
ENSP00000464734 ENSP00000464734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]