SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K7ELR7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K7ELR7
Domain Number 1 Region: 43-145
Classification Level Classification E-value
Superfamily SIS domain 1.37e-25
Family Phosphoglucose isomerase, PGI 0.00000125
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K7ELR7
Sequence length 146
Comment (tr|K7ELR7|K7ELR7_HUMAN) Glucose-6-phosphate isomerase {ECO:0000313|Ensembl:ENSP00000466191} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=GPI OC=Catarrhini; Hominidae; Homo.
Sequence
MVALCSLQHLGSSDPRALPTLPTATSGQRPAKRRRKSPAMAALTRDPQFQKLQQWYREHR
SELNLRRLFDANKDRFNHFSLTLNTNHGHILVDYSKNLVTEDVMRMLVDLAKSRGVEAAR
ERMFNGEKINYTEGRAVLHVALRNRS
Download sequence
Identical sequences K7ELR7
ENSP00000466191 ENSP00000466191

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]