SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K7EMN8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K7EMN8
Domain Number 1 Region: 442-628
Classification Level Classification E-value
Superfamily RNI-like 1.73e-19
Family 28-residue LRR 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K7EMN8
Sequence length 654
Comment (tr|K7EMN8|K7EMN8_HUMAN) NACHT, LRR and PYD domains-containing protein 11 {ECO:0000313|Ensembl:ENSP00000466582} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=NLRP11 OC=Catarrhini; Hominidae; Homo.
Sequence
MRRKFMLQWESHTFGKFHYKFFRDVSSDVFYILQLAYDSTSYYSANNLNVFLMGERASGK
TIVINLAVLRWIKGEMWQNMISYVVHLTAHEINQMTNSSLAELIAKDWPDGQAPIADILS
DPKKLLFILEDLDNIRFELNVNESALCSNSTQKVPIPVLLVSLLKRKMAPGCWFLISSRP
TRGNNVKTFLKEVDCCTTLQLSNGKREIYFNSFFKDRQRASAALQLVHEDEILVGLCRVA
ILCWITCTVLKRQMDKGRDFQLCCQTPTDLHAHFLADALTSEAGLTANQYHLGLLKRLCL
LAAGGLFLSTLNFSGEDLRCVGFTEADVSVLQAANILLPSNTHKDRYKFIHLNVQEFCTA
IAFLMAVPNYLIPSGSREYKEKREQYSDFNQVFTFIFGLLNANRRKILETSFGYQLPMVD
SFKWYSVGYMKHLDRDPEKLTHHMPLFYCLYENREEEFVKTIVDALMEVTVYLQSDKDMM
VSLYCLDYCCHLRTLKLSVQRIFQNKEPLIRPTASQMKSLVYWREICSLFYTMESLRELH
IFDNDLNGISERILSKALEHSSCKLRTLKLSYVSTASGFEDLLKALARNRSLTYLSINCT
SISLNMFSLLHDILHEPTCQISHLRIHRPTRRLTPGIPTLWEAEAGRSPELDEM
Download sequence
Identical sequences K7EMN8
ENSP00000466582 ENSP00000466582

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]