SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K7EQ48 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K7EQ48
Domain Number 1 Region: 4-469
Classification Level Classification E-value
Superfamily SIS domain 2.11e-191
Family Phosphoglucose isomerase, PGI 0.0000000000000186
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K7EQ48
Sequence length 474
Comment (tr|K7EQ48|K7EQ48_HUMAN) Glucose-6-phosphate isomerase {ECO:0000256|RuleBase:RU000612} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=GPI OC=Catarrhini; Hominidae; Homo.
Sequence
MAALTRDPQFQKLQQWYREHRSELNLRRLFDANKDRFNHFSLTLNTNHGHILVDYSKNLV
TEDVMRMLVDLAKSRGVEAARERMFNGEKINYTEGRAVLHVALRNRSNTPILVDGKDVMP
EVNKVLDKMKSFCQRVRSGDWKGYTGKTITDVINIGIGGSDLGPLMVTEALKPYSSGGPR
VWYVSNIDGTHIAKTLAQLNPESSLFIIASKTFTTQETITNAETAKEWFLQAAKDPSAVA
KHFVALSTNTTKVKEFGIDPQNMFEFWDWVGGRYSLWSAIGLSIALHVGFDNFEQLLSGA
HWMDQHFRTTPLEKNAPVLLALLGIWYINCFGCETHAMLPYDQYLHRFAAYFQQGDMESN
GKYITKSGTRVDHQTGPIVWGEPGTNGQHAFYQLIHQGTKMIPCDFLIPVQTQHPIRKGL
HHKILLANFLAQTEALMRGKSTEEARKELQAAGKSPEDLERLLPHKSGAGKAAG
Download sequence
Identical sequences K7EQ48
ENSP00000467670 ENSP00000467670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]