SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K7EQU0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K7EQU0
Domain Number 1 Region: 30-113
Classification Level Classification E-value
Superfamily Integrin domains 1.67e-17
Family Integrin domains 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K7EQU0
Sequence length 139
Comment (tr|K7EQU0|K7EQU0_HUMAN) Integrin alpha-E {ECO:0000313|Ensembl:ENSP00000467977} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=ITGAE OC=Catarrhini; Hominidae; Homo.
Sequence
XHPQPILDRYTEPFAIFQLPYEKACKNKLFCVAELQLATTVSQQELVVGLTKELTLNINL
TNSGEDSYMTSMALNYPRNLQLKRMQKAHVSVVWQLEENAFPNRTADITVTVTKPSIMYV
NTGQGLSHHKEFLFHVHGE
Download sequence
Identical sequences K7EQU0
ENSP00000467977 ENSP00000467977

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]