SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K7EQW4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K7EQW4
Domain Number 1 Region: 35-117
Classification Level Classification E-value
Superfamily RNI-like 1.33e-18
Family 28-residue LRR 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K7EQW4
Sequence length 123
Comment (tr|K7EQW4|K7EQW4_HUMAN) Tropomodulin-4 {ECO:0000313|Ensembl:ENSP00000468006} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=TMOD4 OC=Catarrhini; Hominidae; Homo.
Sequence
XDALCSGEICNTEGISSVVQPDKYKPVPDEPPNPTNIEEILKRVRSNDKELEEVNLNNIQ
AVADMLRENRSLQSLNIESNFISSTGLMAVLKAVRENATLTELRVDNQVASKRRDNTAFP
FTN
Download sequence
Identical sequences K7EQW4
ENSP00000468006 ENSP00000468006

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]