SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K7ERK8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K7ERK8
Domain Number 1 Region: 43-133
Classification Level Classification E-value
Superfamily SIS domain 2.98e-19
Family Phosphoglucose isomerase, PGI 0.00000288
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K7ERK8
Sequence length 133
Comment (tr|K7ERK8|K7ERK8_HUMAN) Glucose-6-phosphate isomerase {ECO:0000313|Ensembl:ENSP00000468298} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=GPI OC=Catarrhini; Hominidae; Homo.
Sequence
MVALCSLQHLGSSDPRALPTLPTATSGQRPAKRRRKSPAMAALTRDPQFQKLQQWYREHR
SELNLRRLFDANKDRFNHFSLTLNTNHGHILVDYSKNLVTEDVMRMLVDLAKSRGVEAAR
ERMFNGEKINYTE
Download sequence
Identical sequences K7ERK8
ENSP00000468298 ENSP00000468298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]