SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K7ETT1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K7ETT1
Domain Number 1 Region: 114-268
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.83e-48
Family Hypothetical protein AT3g04780/F7O18 27 0.0000555
Further Details:      
 
Domain Number 2 Region: 4-108
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.46e-22
Family Thioltransferase 0.00000326
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K7ETT1
Sequence length 292
Comment (tr|K7ETT1|K7ETT1_PONAB) Thioredoxin like 1 {ECO:0000313|Ensembl:ENSPPYP00000023954} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=TXNL1 OC=Catarrhini; Hominidae; Pongo.
Sequence
MVGVKPVGSDPDFQPELSGAGSRLAVVKFTMRGCGPCLRIAPAFSSMSNKYPQAVFLEVD
VHQCQGTAATNNISATPTFLFFRNKVRIDQYQGADAVGLEEKIKQHLENDPGSNEDTDIP
KGYMDLMPFINKAGCECLNESDEHGFDNCLRKDTTFLESDCDEQLLITVAFNQPVKLYSM
KFQGPDNGQGPKYVKIFINLPRSMDFEEAERSEPTQALELTEDDIKEDGIVPLRYVKFQN
VNSVTIFVQSNQGEEETTRISYFTFIGTPVQATNMNDFKRKIHIGKLRVINL
Download sequence
Identical sequences A0A2I3SXN8 A0A2K5EAF7 A0A2K6TTZ2 K7ETT1
ENSPPYP00000023954 XP_006722643.1.92137 XP_008978120.1.60252 XP_009432333.1.37143 XP_010335082.1.74449 XP_012301867.1.9421 ENSPPYP00000023954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]