SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K7EU44 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K7EU44
Domain Number 1 Region: 71-149
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 7.32e-26
Family Intermediate filament protein, coiled coil region 0.0000214
Further Details:      
 
Weak hits

Sequence:  K7EU44
Domain Number - Region: 14-68
Classification Level Classification E-value
Superfamily Prefoldin 0.00034
Family Prefoldin 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K7EU44
Sequence length 153
Comment (tr|K7EU44|K7EU44_PONAB) Uncharacterized protein {ECO:0000313|Ensembl:ENSPPYP00000024067} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN= OC=Catarrhini; Hominidae; Pongo.
Sequence
MDMSKPDLTAALRDIRAQYETIAAKNISEAEEWYKSKVSDLTQAANKNNDALRQAKQEMM
EYRHQIQSYTCEIDALKGTNDSLMRQMRELEDRFASEASGYQDNIARLEEEIRHLKDEMA
RHLREYQDLLNVKMALDVEIATYRKLLEGEESR
Download sequence
Identical sequences K7EU44
ENSPPYP00000024067 ENSPPYP00000024067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]