SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K7EUZ5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K7EUZ5
Domain Number 1 Region: 207-264
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.5e-22
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 2 Region: 263-320
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.35e-21
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 3 Region: 319-374
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.38e-19
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 4 Region: 151-208
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.21e-18
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 5 Region: 3-58
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.44e-18
Family KRAB domain (Kruppel-associated box) 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K7EUZ5
Sequence length 708
Comment (tr|K7EUZ5|K7EUZ5_PONAB) Uncharacterized protein {ECO:0000313|Ensembl:ENSPPYP00000024372} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN= OC=Catarrhini; Hominidae; Pongo.
Sequence
MDQASVALEDVAVNFTREEWALLGPCQKNLYKDVMQETIRNLDCVGMKWKDQNIEDQYRY
PRKNLRCCMLERFVESKDGSQCGETSRQIQDSIVTKNTLPGVGPCESSMSGEIVMGHSSL
NYYIRAGAGHKPHEYHECGEKPDTHKQCGKAFSYHNSFQTHERLHTGKKPYDCKECGKSF
SSLGSLQRHMAVQRGDGPYKCKLCGKAFFWPSLLYMHERTHTGEKPYECKQCSKAFSFYS
SYLRHERTHTGEKPYECKHCSKAFPDYSSCLRHERTHTGEKPYTCKQCGKAFSASTSLQR
HETTHSAEKPYACQQCGKAFHHLGSFQRHMIRHTGNGPHKCKICGKGFDCPSSLQSHERT
HTGEKPYECKQCGKALSHRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLIHLSMH
PSTHQFIQPPFEPIHLSVHPSSHPSRHHLSIHSSIHPSHPPIHPFIYPSTHTPTHPPIHP
SIHPSIDPHIHPSIHPSIPSIQLPIHPPIHSSIYLSTHPSIHPSFIYPSICQSIHSSISS
IHPSHSPTHHLCTHPSIHAFICPSTHTPIRPSIHPSIHPSIHPSIHSPIQPSTHPTHPSI
HLSIHPSIHPSTHPLTHPFIHPLIHLSMHPSNPFTWLSLHPSVHPSTHPSIYLSTNCLIT
SSSFTISSIIYHPFSDVFIYPSTHSSLHCNRPSIYSSTHPSIQATRQC
Download sequence
Identical sequences K7EUZ5
ENSPPYP00000024372 ENSPPYP00000024372

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]