SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K7EV16 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K7EV16
Domain Number 1 Region: 275-338
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000103
Family LIM domain 0.039
Further Details:      
 
Weak hits

Sequence:  K7EV16
Domain Number - Region: 333-359
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00332
Family LIM domain 0.029
Further Details:      
 
Domain Number - Region: 243-278
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0963
Family LIM domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K7EV16
Sequence length 365
Comment (tr|K7EV16|K7EV16_PONAB) LMCD1 isoform 1 {ECO:0000313|EMBL:PNJ67993.1} KW=Complete proteome; Reference proteome OX=9601 OS=Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). GN=CR201_G0011323 OC=Catarrhini; Hominidae; Pongo.
Sequence
MAKVAKDLNPGVKKMSLGQLQSARGVACLGCKGTCSGFEPHSWRKICKSCKCSQEDHCLT
SDLEDDRKIGRLLMDSKYSTLTARVKGGDGIRIYKRNRMIMTNPIATGKDPTFDTITYEW
APPGVTQKLGLQYMELIPKEKQPVTGTEGAFYRRRQLMHQLPIYDQDPSRCRGLLENELK
LMEEFVKQYKSEALGVGEVALPGQGGLPKEEGKQQEKPEGAETTAATTNGSLSDPSKEVE
YVCELCKGVAPPDSPVVYSDRAGYNKQWHPTCFVCAKCSEPLVDLIYFWKDGAPWCGRHY
CESLRPRCSGCDEIIFAEDYQRVEDLAWHRKHFVCEGCEQLLSGRAYIVTKGQLLCPTCS
KSKRS
Download sequence
Identical sequences G3SDR1 K6ZQS3 K7EV16
ENSGGOP00000013572 XP_002813534.1.23681 XP_004033580.1.27298 ENSPPYP00000024394 ENSPPYP00000024394 ENSGGOP00000026241

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]