SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K7F496 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K7F496
Domain Number 1 Region: 80-360
Classification Level Classification E-value
Superfamily L domain-like 1.7e-53
Family Ngr ectodomain-like 0.0012
Further Details:      
 
Domain Number 2 Region: 418-516
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000665
Family Fibronectin type III 0.0031
Further Details:      
 
Weak hits

Sequence:  K7F496
Domain Number - Region: 35-78
Classification Level Classification E-value
Superfamily L domain-like 0.000527
Family Ngr ectodomain-like 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K7F496
Sequence length 661
Comment (tr|K7F496|K7F496_PELSI) Fibronectin leucine rich transmembrane protein 2 {ECO:0000313|Ensembl:ENSPSIP00000002856} KW=Complete proteome; Reference proteome OX=13735 OS=Pelodiscus sinensis (Chinese softshell turtle) (Trionyx sinensis). GN=FLRT2 OC=Pelodiscus.
Sequence
MGLWTRMWFKDWAAFLNSWLIISLGLLMQVSKTLACPNVCRCDRNFVYCNERSLTSVPLG
IPEGVTVLYLHNNQINNAGFPAELHNVQSVHTVYLYGNQLDEFPMNLPKNVRVLHLQENN
IQTISRAALAQLLKLEELHLDDNSISTVGVEDGAFREAVSLKLLFLSKNHLSSVPVGLPV
DLQELRVDENRIAIISDMAFQNLTSLERLIVDGNLLTNKGIAEGTFGHLTKLKEFSIVRN
SLSYPPPDLPGTHLLRLYLQDNQITHIPLSAFSNLHKLERLDISNNQLRMLVKGVFDNLH
NLKQLTARNNPWLCDCSIKWVTEWLKFIPSSINVRGFMCQGPEQVRGMAVRELNMNMLSC
PTTTPGLPIITPAPATTLPTTLAPTSSVPNPTDKHSPFPPTTSTLPTVPDKEGGERVTPP
ISERIQLSIHFVNDTCIQVHWLSLFTVMAYKLTWVKMGHSLIGGIVQERIVSGEKQHLSL
LNLEPKSTYRICLVPLDAFNNYRAGEDTVCSEATTKASHLNNGSNTASSHEQTTTQNMGS
PFLLAGLIGGAVIFVLVVLLSIFCWHMHKKGRYTSQKWKYNRGRRKDDYCEAGTKKDNSI
LEMTETSFQIVSLNNDQLLKGDFRLQPIYTPNGGINYTDCHIPNNMRYCNSSVSDLEHCH
T
Download sequence
Identical sequences K7F496
ENSPSIP00000002856 XP_006112095.1.96668 XP_006112096.1.96668 XP_006112098.1.96668 XP_006112099.1.96668 XP_006112100.1.96668 XP_006112101.1.96668 XP_006112103.1.96668 XP_006112104.1.96668 XP_006112105.1.96668 XP_006112106.1.96668 XP_006112107.1.96668 XP_006112108.1.96668 ENSPSIP00000002856

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]