SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K7F518 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K7F518
Domain Number 1 Region: 807-897
Classification Level Classification E-value
Superfamily PH domain-like 4.78e-21
Family Third domain of FERM 0.018
Further Details:      
 
Domain Number 2 Region: 690-806
Classification Level Classification E-value
Superfamily Second domain of FERM 6.15e-21
Family Second domain of FERM 0.0027
Further Details:      
 
Domain Number 3 Region: 1-91
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000000672
Family Ras-binding domain, RBD 0.057
Further Details:      
 
Domain Number 4 Region: 83-176
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000000000000196
Family Second domain of FERM 0.0054
Further Details:      
 
Domain Number 5 Region: 590-697
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000475
Family Ubiquitin-related 0.091
Further Details:      
 
Weak hits

Sequence:  K7F518
Domain Number - Region: 304-368
Classification Level Classification E-value
Superfamily SH3-domain 0.0114
Family SH3-domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K7F518
Sequence length 911
Comment (tr|K7F518|K7F518_PELSI) Uncharacterized protein {ECO:0000313|Ensembl:ENSPSIP00000003128} KW=Complete proteome; Reference proteome OX=13735 OS=Pelodiscus sinensis (Chinese softshell turtle) (Trionyx sinensis). GN= OC=Pelodiscus.
Sequence
MNGQSITVPADSASIAKEICQLIADKTKLKDTFGFSLYIAVYDKVWSLGSGRDHVMDAIS
QCEQLVKEQGAHERNAPWRLYFRKEIFTPWHNSKEDPVSTELIYHQIIRGVRFGEYRCDK
EEDLVEIGAKYCYIQFGDSIRNELVQKLLQDCIPAKLLKSKPQEKWVSLLTYAHAKAPYT
QDRLSPQTVKEQLVDFARFQWPLLFSRFFEVTKFSGPSLPKNHFIVAINWKGICFLEESE
KRLLDLSFPEITGIHTNRAVKSFGQCCTLITLRAEEFVLTSVHSVVIAELVVLFLEGLKK
RSQYAVAMQDSKQQGDPAILAFKKGDLLILTQDKELEANRGAWVYAQNERTAKTGAVSLE
AIYVIPSIAKPASQILSLLMMSPDQRRLASLTSRTEEAEEEEVKVKPYTLEEFSYEHFRV
PEKESLSKAVLHKSRGRSQLWAHSKEPLKQPLLKKVCADPGLQDLACQAFIAIMKFMGDY
PSKQARSSVELTDQIFVAAIQEEVLRDEIYCQIMKQLTENSNRYSVNSGWQLLWLCTGLF
PPSKSLLKHAQKFMETRQKEPLALDCSRRIQRVMRYGCRKWAPHNVEVEAIQQNITKISQ
KVCFPNDTEQVFEVGTNSRIRSLCQNIASKLQLSSWEGFSLFIKTTDKVISQNEADYFFD
SLRQVTDWTRKNKPVKDGGAVAVTYQVYFMRKLWLSVTPGKDLKADSIFHYHQELPKYLR
GYHKCSKEEAAQIAGLIYKVRFDRDRSQQAAIPKILRELVPDNLVRAMALEEWKKNIISA
YSRHEGKTVDEAKVAFLKMIHRWPTFGSAFFEVKQTSEPNFPDIVLIAVNRQGVSLIHPK
TKDILIVYPYNKISNWNSGSTFFHMTIGNLVRGSRILCETSLGYKMDDLLTSYVQLLMNA
VNKQRNPRLPA
Download sequence
Identical sequences K7F518
ENSPSIP00000003128 ENSPSIP00000003128

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]