SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K7F7G3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K7F7G3
Domain Number 1 Region: 2-201
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 6.16e-60
Family Nuclear receptor ligand-binding domain 0.0000000169
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K7F7G3
Sequence length 265
Comment (tr|K7F7G3|K7F7G3_PELSI) Hepatocyte nuclear factor 4 gamma {ECO:0000313|Ensembl:ENSPSIP00000003973} KW=Complete proteome; Reference proteome OX=13735 OS=Pelodiscus sinensis (Chinese softshell turtle) (Trionyx sinensis). GN=HNF4G OC=Pelodiscus.
Sequence
MKQQLLVLVEWAKYIPAFCELPLDDQVALLRAHAGEQLLLGAAKRSMVYKDILLLGNNCI
IHRNSSEVEISRVANRILDELVRPFQEIQIDDNEYACLKAIVFFDPDAKGLSDPLKIKNM
RFQVQISLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQLVKLFGMVKIDSLLQ
EMLLGGTSNDVSHLHHPVHPHLAQDPLTGQTILISSMSTPVHTEPISTPETPLPSPPQGS
GQEYKMSTNQATVITQQSILKQKPL
Download sequence
Identical sequences K7F7G3
ENSPSIP00000003973 ENSPSIP00000003973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]