SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K7F8S3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K7F8S3
Domain Number 1 Region: 6-161
Classification Level Classification E-value
Superfamily TRADD, N-terminal domain 1.31e-61
Family TRADD, N-terminal domain 0.00000538
Further Details:      
 
Domain Number 2 Region: 213-297
Classification Level Classification E-value
Superfamily DEATH domain 8.24e-16
Family DEATH domain, DD 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K7F8S3
Sequence length 304
Comment (tr|K7F8S3|K7F8S3_PELSI) TNFRSF1A associated via death domain {ECO:0000313|Ensembl:ENSPSIP00000004433} KW=Complete proteome; Reference proteome OX=13735 OS=Pelodiscus sinensis (Chinese softshell turtle) (Trionyx sinensis). GN=TRADD OC=Pelodiscus.
Sequence
MAGSSELWIGSAYLFLQSTSEKIVLPSLYGSSQQKSSIFKALKLAFADSTGSLDGVDMLK
VHCSEPHLIIQLKFCVRENCRKFLRSYRAGLFRESLQNHLRVTLSVTAVSVEVELKTGSE
QLDHMLNEEERCLDYIYKEKPDRLRDEEIAELEESFRSLTCQQKSNNTNEYNSLNSSSLH
YCSGGSTLPAGATFIFQEQQFVNRTLTPDDHQKFAKLVSKKWKQVGRSLQKSCRALRDPV
IDNLAHEYDREGLYEQAYQLLLRFIQSEGKRATLQRLIAALAENSLISIAEDLLGLHHSE
NNTS
Download sequence
Identical sequences K7F8S3
ENSPSIP00000004433 XP_006121021.1.96668 ENSPSIP00000004433

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]