SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K7FCH4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K7FCH4
Domain Number 1 Region: 297-439
Classification Level Classification E-value
Superfamily PH domain-like 7.38e-40
Family Third domain of FERM 0.00000942
Further Details:      
 
Domain Number 2 Region: 193-298
Classification Level Classification E-value
Superfamily Second domain of FERM 4.19e-37
Family Second domain of FERM 0.00000284
Further Details:      
 
Domain Number 3 Region: 112-192
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.68e-27
Family First domain of FERM 0.0000959
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K7FCH4
Sequence length 881
Comment (tr|K7FCH4|K7FCH4_PELSI) Erythrocyte membrane protein band 4.1 like 3 {ECO:0000313|Ensembl:ENSPSIP00000005734} KW=Complete proteome; Reference proteome OX=13735 OS=Pelodiscus sinensis (Chinese softshell turtle) (Trionyx sinensis). GN=EPB41L3 OC=Pelodiscus.
Sequence
MTTESGSDSESKDQDQDQQEAPAQQGTAGTQPQDQQQLSEEHQNAIDQFSAVAAHSTPVK
KEQVTEREQEFAAAAAKQLEYQQFEEDKLSQKSSCSKLSRSPLKIVKKPKNMQCKVTLLD
GSEYGCEVEKRSRGQILFDKVCEHLNLLEKDYFGLTYRDMENQKNWLDPAKEIKKQIRSG
AWQFSFNVKFYPPDPSQLSEDITRYYLCLQLRDDIVSGRLPCSFVTLALLGSYTVQSELG
DYDPDEYGGDYVSEFRFAPNHTKELEDKVIELHKSHRGMTPAEAEMHFLENAKKLSMYGV
DLHHAKDSEGVEIMLGVCASGLLIYRDRLRINRFAWPKVLKISYKRNNFYIKIRPGEFEQ
FESTIGFKLPNHRAAKRLWKVCVEHHTFFRLLLPEAPPKKFLTLGSKFRYSGRTQAQTRR
ASALIDRPAPYFERSSSKRYTMSRSLDGASVNENHEMYMKDSMSAAEVGTGQYATTKGIS
QTNLITTVTPEKKPEEERDEEEGKKKGEEITPVSAIRHDTKELDKNQEDLMKHQTNISEL
KRTFLETSTDTAVTNEWEKRLSTSPVRLATRHEEAPMIEPLVPEETKEEKEKSEKLIFLQ
KGSSTFLESQRTEATTGQQISAREMKQEIQSHQDAAKKVVQETVLVEERYMTNVHASGDA
VKLAGNLLDAMAQAVSAEASSITGKEGSAVTEGDKEKKREEADKAVAKQEEIAAASHLQE
EEQSATVHVSDTLERKPHFEQSPILKTETISFDSVSPGGEKLEISSKEVPVVHTETKTIT
YESSQTDSGADSEPGVLMSAQTITSETTSTTTTTHITKTVKGGISETRIEKRIVITGDAD
IDHDQALAQAIKEAKEQHPDMSVTKVVVHKETEITPEDGED
Download sequence
Identical sequences K7FCH4
XP_006139076.1.96668 ENSPSIP00000005734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]