SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K7FE36 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K7FE36
Domain Number 1 Region: 261-453
Classification Level Classification E-value
Superfamily Nudix 6.09e-44
Family NADH pyrophosphatase 0.0012
Further Details:      
 
Domain Number 2 Region: 14-100
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.37e-18
Family Ankyrin repeat 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K7FE36
Sequence length 459
Comment (tr|K7FE36|K7FE36_PELSI) Nudix hydrolase 12 {ECO:0000313|Ensembl:ENSPSIP00000006296} KW=Complete proteome; Reference proteome OX=13735 OS=Pelodiscus sinensis (Chinese softshell turtle) (Trionyx sinensis). GN=NUDT12 OC=Pelodiscus.
Sequence
MTNTERSPKQQMISQLHNFAATGDKVRLTALCSQSPSLINEAAENGWTALMYAARNGRFE
IVQILLEKGCDRSIVNKSSQTALDIAKFWGYKHIANLLENVKGGQKPFFLPNYVREYENY
FSRTLLDRRSDKRTDSKWLNRKQNHPATIYILFSNLSPLVTLGGGEDSYQQPEVRLCRLC
HKDVKEYMSQTEEVTLIFLGVELQLASLNGRVLKEDEDDGLVAWFALSIDATFAEQFKQK
HEDCYFLHPPMPALLQLPEREAGIVAQARSVLAWHNRYQFCPTCGSSTKIEEGGYKKTCL
KEDCPSLQGVHNTSYPRIDPVVIMQVLHPDGNQCLLGRQKRFPPGLFTCLAGFVEPGETI
EDAVRREVEEESGVKIGHVQYVSCQPWPMPSSLMIGCLAVAISTEIRVDKNEIEDARWFT
REQVVDVLIKGNQHSFLVPPSQAIAHQLIKHWIGMNANL
Download sequence
Identical sequences K7FE36
XP_006116180.1.96668 XP_006116181.1.96668 ENSPSIP00000006296 ENSPSIP00000006296

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]