SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K7FF69 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K7FF69
Domain Number 1 Region: 46-60,182-349
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 7.08e-37
Family Nuclear receptor ligand-binding domain 0.00000406
Further Details:      
 
Domain Number 2 Region: 2-61
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.32e-16
Family Nuclear receptor 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K7FF69
Sequence length 351
Comment (tr|K7FF69|K7FF69_PELSI) Nuclear receptor subfamily 5 group A member 1 {ECO:0000313|Ensembl:ENSPSIP00000006679} KW=Complete proteome; Reference proteome OX=13735 OS=Pelodiscus sinensis (Chinese softshell turtle) (Trionyx sinensis). GN=NR5A1 OC=Pelodiscus.
Sequence
QGFFKRTVQNNKHYTCTESQNCKIDKTQRKRCPYCRFQKCLTVGMRLEAVRADRMRGGRN
KFGPMYKRDRALKQQKKALIRANGFKLETVPQIVSPVQTDYSLSSAIHGIHSVAKSLPPN
PAAMTPVDYDRSPYGTPSLGMTVPSHGALSSYHYPAFPNRTIKSEYPDHYTSSHESVASY
MYPDAYPSSSPPDIPEVILKLLQLEPDEPQVKARILACLQQEQGKGRHEKLHTFGLMCKM
ADQTLFSIVEWARSCVFFKELEVGDQMKLLQNCWSELLVFDHIYRQVQHGKEHSMLLVTG
QEGGYTLPMNQAPAPIQGMNKHRARLVLHLQSLQVDRQEFVCLKFLILFSL
Download sequence
Identical sequences K7FF69
ENSPSIP00000006679 ENSPSIP00000006679

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]