SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K7FG95 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K7FG95
Domain Number 1 Region: 743-989
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.54e-63
Family Nuclear receptor ligand-binding domain 0.0000000589
Further Details:      
 
Domain Number 2 Region: 603-687
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.1e-24
Family Nuclear receptor 0.0000235
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K7FG95
Sequence length 991
Comment (tr|K7FG95|K7FG95_PELSI) Nuclear receptor subfamily 3 group C member 2 {ECO:0000313|Ensembl:ENSPSIP00000007055} KW=Complete proteome; Reference proteome OX=13735 OS=Pelodiscus sinensis (Chinese softshell turtle) (Trionyx sinensis). GN=NR3C2 OC=Pelodiscus.
Sequence
METKGYYSCPEGLDMEKRWGQVSQSVQYSSGAGEQTDESNYMEIVNVSCVSGAFPNSNAQ
GNSKEKPELLPSLQQDNNQPGILNSDIKSESDSKELSATVAESMGLYMDSIRDADFTYDQ
QNQQGSISPGKTYQNVEQLVKLYKENGHCASPLNSANRPLRSLVSDSGNSMNGGLIHTIV
KSPVTCPERAPSGCSPQRMTSVCSPAGFNCVSSTTSTNFVNFPVHSPISQGTPLSCSPNI
ENRGSRLHSPAHVSNVGSPLSSPISSMKSPISSPPSHCSVKSPVSSPNNVTMRSSVSSPA
NMNSRCSIASPSNTNNRSSLSSPAVSTVGSSICSPVNNALSFPASGTPSGPNTGQDTIPS
PETKDKGAQEITFPKMENAISNNCVAGQMNLVQFIKPDPDGAFSTSCVGENSKINSDSPF
SVPVKQESTKHSCSGVSFKGNQGVNPFPFMDGSYFSFMDDKDYYSLSGILGPPVSSFDVN
CESSGFPNPGLSVGIKQEPNDGSYFQESSMPSSAIVGVNSGGQSFHYRIGAQGTISLSRP
LAREQTFQHVSSFPPVGTLVETWKSHSDLSSRRNDGYPVLEYIPENVSSSSLRSVSTGSS
RPSKVCLVCGDEASGCHYGVVTCGSCKVFFKRAVEGKCSWQHNYLCAGRNDCIIDKIRRK
NCPACRLQKCLQAGMNLGARKSKKLGKLKGMHEEQQQQQQQQQQQPPPQSPEEGTTYIAP
VKEPSVNTALVPHLSAISPALAPSPIMILESIEPEIVYAGYDNSKPDTAEHLLSTLNRLA
GKQMVQVVKWAKILPGFRNLPLEDQITLIQYSWMCLSSFALSWRSYKHTNSQFLYFAPDL
VFNEERMRQSAMFELCQGMHQISLQFVRLQISFEEYTIMKVLLLLSTVPKDGLKSQAAFE
EMRANYIKELRKMVTKCPSNSGQSWQRFYQLTKLLDSMHDLVSDLLEFCFYTFRESQALK
VEFPAMLVEIISDQLPKVESGNAKPLYFHRK
Download sequence
Identical sequences K7FG95
XP_014434420.1.96668 ENSPSIP00000007055 ENSPSIP00000007055

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]