SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K7FHB2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K7FHB2
Domain Number 1 Region: 1-193
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 8.2e-54
Family BAR domain 0.0014
Further Details:      
 
Domain Number 2 Region: 185-217,249-306
Classification Level Classification E-value
Superfamily SH3-domain 6.48e-18
Family SH3-domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K7FHB2
Sequence length 307
Comment (tr|K7FHB2|K7FHB2_PELSI) SH3 domain containing GRB2 like, endophilin B1 {ECO:0000313|Ensembl:ENSPSIP00000007422} KW=Complete proteome; Reference proteome OX=13735 OS=Pelodiscus sinensis (Chinese softshell turtle) (Trionyx sinensis). GN=SH3GLB1 OC=Pelodiscus.
Sequence
MKQTEVLLQPNPNARIEEFVYEKLDRKAPSRVNNPEQLGQYMIDAGNEFGPGTAYGNALI
KCGETQKRIGTADRELIQTSAINFLTPLRNFIEGDYKTITKERKLLQNKRLDLDAAKTRL
KKAKVAEARAASEQEVRITQSEFDRQAEITRLLLEGISSTHAHHLRCLNDFVEAQMTYYA
QCYQYMLDLQKQLGSFPSTFLSNNNQSSSTPVPSVSASSVLASASASLPSVSNSVVTSGF
SELKSSSGSTKARVLYDYDAANSSELSLLADEVITVYSIPGMDSDWLMGERGNQKGKVPI
TYLQLLN
Download sequence
Identical sequences K7FHB2
ENSPSIP00000007422 ENSPSIP00000007422 XP_014427574.1.96668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]