SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K7FLQ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K7FLQ8
Domain Number 1 Region: 775-1070
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.19e-91
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000077
Further Details:      
 
Domain Number 2 Region: 108-252
Classification Level Classification E-value
Superfamily PH domain-like 2.31e-31
Family Third domain of FERM 0.0044
Further Details:      
 
Domain Number 3 Region: 9-107
Classification Level Classification E-value
Superfamily Second domain of FERM 3.4e-23
Family Second domain of FERM 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K7FLQ8
Sequence length 1074
Comment (tr|K7FLQ8|K7FLQ8_PELSI) Tyrosine-protein phosphatase non-receptor type {ECO:0000256|PIRNR:PIRNR000934} KW=Complete proteome; Reference proteome OX=13735 OS=Pelodiscus sinensis (Chinese softshell turtle) (Trionyx sinensis). GN= OC=Pelodiscus.
Sequence
MSCFVSLTYRYQYYLQVKKDVLDGRLRSSLDQGIRLAGLAVQADFGDCNQFESHDFLREY
VLFPMDWTQDEAVLEDLTQKVAQEHKTHSGIPAAEAELMYISEVERLEGFGQESFPVKDN
HGNDLHLGIFFMGIFIKNRIGRPTVIYSRWNDIGNIIHNKSSIIVELINKEETVLFHTDD
IENAKYISRLFAARHKFYKHNKICTEQSSSPPPIRRRPTWSRSSLPRQHPFIMPPMHVQC
GEHYTETHNSQDSIFHGNEETFYCRSQTSLDRCPVDFSYLNGNGPNGSMCSAHSMNSLNR
SQNFVQASPMSSNLSIPGSDIMRADYIPSHRHSAIIVPSYRPTPDYETVMRQMKRGVIHM
DSQSQSLRNLNIGNTHAYNQPEDLVYSQPEIRERHPYTVPYGPHGSYNKPVAPSDQMNPN
NAVQNKTAASAISHTVSTPELTNMQLQSSQSYSTAHMLKNYLFRPPPPYPCPRPATSTPD
LASHRHKYVSGSSPDLVTRKVQLSVKTFQEDSLPVVHQSLQEVSEPLLAVKHHAALNKRH
SLEVISNMVRGIEAMALKTLNAPLPRRNTLREQVQPGEQPPCYHHKKTLSTATMLIHSSE
SEEEGEAAESVSQIAPLHENVEYSAQLQAALARIPNKPPPEYPGPRKSVSNGALRQDQAS
ISVAVARAKAMRPGPTKAISVSRTDQMSINGSSLGPSISEPDLTSVKERVKKEPVKERPV
SEMFSIEDSIIETKKNLEKQKMAGLEAQKRPLMLAALNGLSVARVPVPEDSQDEGAKVPM
DERCKILKRKLEEGMVFTEYEQIQKKKADGIFTTAALPENAERNRIREVVPYEENRVELV
PTKENNTGYINASHIKVTVGGEEWHYIATQGPLSHTCHDFWQMVWEQGVNVIAMVTAEEE
GGRSKSHRYWPKLGSKHSSATYGKFKVTTKFRTDSGCYATTGLKVKHLLSGQEKTVWHLQ
YTDWPDHGCPEEVQGFLSYLEEIQSVRRHTNSVLDASNNCNPPIVVHCSAGVGRTGVVIL
TELMIGCLEHNEKMDVPVMLRQLREQRMFMIQTIAQYKFVYRVLIQFLQNSRLI
Download sequence
Identical sequences K7FLQ8
ENSPSIP00000008968 ENSPSIP00000008968

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]