SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K7FM28 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K7FM28
Domain Number 1 Region: 267-513
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.31e-68
Family Nuclear receptor ligand-binding domain 0.000000000514
Further Details:      
 
Domain Number 2 Region: 181-246
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000255
Family Nuclear receptor 0.0000288
Further Details:      
 
Weak hits

Sequence:  K7FM28
Domain Number - Region: 121-143
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000202
Family Nuclear receptor 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K7FM28
Sequence length 515
Comment (tr|K7FM28|K7FM28_PELSI) Thyroid hormone receptor beta {ECO:0000313|Ensembl:ENSPSIP00000009088} KW=Complete proteome; Reference proteome OX=13735 OS=Pelodiscus sinensis (Chinese softshell turtle) (Trionyx sinensis). GN=THRB OC=Pelodiscus.
Sequence
MSYCMQEIYEVHPAAGSNCYMQSADYCTYIEDSQSYSSCDAQVLHNNNIYMEQAWAVNQP
YTCSYPGNVFKSEYSDMDMALNQYNQPEYFTEEKPTFSQVQSPSYSQKKGYIPSYLDKDE
LCVVCGDKATGYHYRCITCEGCKKKSHVYQEARFVWFWQNATATSVLCLIILHTSRCFPL
GFFRRTIQKNLHPTYSCKYEGKCVIDKVTRNQCQECRFKKCIYVGMATDLVLDDSKRLAK
RKLIEENREKRRREELQKTVGHKPEPTDEEWELIKIVTEAHVATNAQGSHWKQKRKFLPE
DIGQAPMVNAPESGKVDLEAFSQFTKIITPAITRVVDFAKKLPMFCELPCEDQIILLKGC
CMEIMSLRAAVRYDPESETLTLNGEMAVTRGQLKNGGLGVVSDAIFDLGMSLSSFNLDDT
EVALLQAVLLMSSATDRPGLLSVERIEKCQEGFLLAFEHYINYRKHHVAHFWPKLLMKVT
DLRMIGACHASRFLHMKVECPTELFPPLFLEVFED
Download sequence
Identical sequences K7FM28
ENSPSIP00000009088 ENSPSIP00000009088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]