SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K7FMZ9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K7FMZ9
Domain Number 1 Region: 386-581
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 6.03e-68
Family Nuclear receptor ligand-binding domain 0.0000144
Further Details:      
 
Domain Number 2 Region: 104-194
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.22e-29
Family Nuclear receptor 0.0000159
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K7FMZ9
Sequence length 583
Comment (tr|K7FMZ9|K7FMZ9_PELSI) Nuclear receptor subfamily 1 group D member 2 {ECO:0000313|Ensembl:ENSPSIP00000009409} KW=Complete proteome; Reference proteome OX=13735 OS=Pelodiscus sinensis (Chinese softshell turtle) (Trionyx sinensis). GN=NR1D2 OC=Pelodiscus.
Sequence
MSSLHSFLSLPPGGVIAYISSSSASSPASCHSESSESSFQSSSSPVPSSPNSSSSESSYN
SRSSEGSDGASKNDRMDSAVKTSRSSAAGLTKGHGGLTKFNGMVLLCKVCGDVASGFHYG
VHACEGCKGFFRRSIQQNIQYKKCLKNNNCSIMRMNRNRCQQCRFKKCLSVGMSRDAVRF
GRIPKREKQRMLIEMQSAMKTMMNSQFNGHLPNDALTEHQEQTPPLSQEELIPKPQHELE
NIKSPSPPPSSDIAKEEVIGMVTRAHKDTFMYNQEQSENPVEAMQPQSGKRIPKHPEQYT
LNSDHCGSGLSDTQYIESEQHLAGQYKGTNVTHYPNGRTVCFANGHSLNFSNGYTQGMCD
RIPEDGFSANENLNIYSCNTGGRMHLVCPMSKTPFVDPLKSGHEVWEEFSMSFTPAVKEV
VEFAKRIPGFRDLSQHDQVNLLKAGTFEVLMVRFASLFDAKERTVTFLSGKKYRVDDLHS
MGAGDLLNSMFEFSEKLNGLQLSDEEMSLFTAVVLVSADRSGIENVNSVEALQETLIRAL
RTLIMKNHPNEASVFTKLLLKLPDLRSLNNMHSEELLAFKVHP
Download sequence
Identical sequences K7FMZ9
ENSPSIP00000009409 ENSPSIP00000009409 XP_006134400.1.96668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]