SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K7FPF2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K7FPF2
Domain Number 1 Region: 86-191
Classification Level Classification E-value
Superfamily Second domain of FERM 1.31e-32
Family Second domain of FERM 0.0000885
Further Details:      
 
Domain Number 2 Region: 189-291
Classification Level Classification E-value
Superfamily PH domain-like 6.15e-27
Family Third domain of FERM 0.0027
Further Details:      
 
Domain Number 3 Region: 14-84
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.82e-22
Family First domain of FERM 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K7FPF2
Sequence length 561
Comment (tr|K7FPF2|K7FPF2_PELSI) FERM domain containing 5 {ECO:0000313|Ensembl:ENSPSIP00000009912} KW=Complete proteome; Reference proteome OX=13735 OS=Pelodiscus sinensis (Chinese softshell turtle) (Trionyx sinensis). GN=FRMD5 OC=Pelodiscus.
Sequence
MQRGECYIRANSIRVAVDKKRDAKGQYLFDLLCHHLNLLEKDYFGIRFVDPDKQRHWLEF
TKSVVKQMRAQPPFTMCFRVKFYPTDPAALKEEITRYLVFLQIKRDLYHGRLLCKTSDAA
LLAAYILQAEIGDYDPGKHPEGYSSKFQFFPKHSEKLERKIAEIHKTELSGQTPATSELN
FLRKAQTLETYGVDPHPCKDVSGNAAFLAFTPFGFVVLQGNKRIHFIKWNEVTKMKFEGK
TFYLYVSQKEEKKIVLTYFAPTPEACKHLWKCGIENQAFYKLRESTSVSSARHSHQELGG
TKGAWGAELGREGPEGAGGVRPLPPQGHQNGHAGSDQWPVSYHAWSQSPGAPMWRRTRGH
VVLKEESLESLRDSAHSTPVRSASHSDAFLPPVRSSRVDSSERVAIISDEIYSPADSVLP
TPVAEHSLELMLLSRQINGAPCSIEEEKESEANTPTATEADEMRGEFKALCQGVGGTGGT
QATQVNKFVLSVLRLLLVTVGLLFVLLLLLIILTESDLDVAFFRDIRQTPEFEQFHYQYF
CPLRRWFACKVRSVLSLLIDT
Download sequence
Identical sequences K7FPF2
ENSPSIP00000009912

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]