SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K7FPT4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K7FPT4
Domain Number 1 Region: 306-544
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.54e-63
Family Nuclear receptor ligand-binding domain 0.000000192
Further Details:      
 
Domain Number 2 Region: 50-133
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.79e-29
Family Nuclear receptor 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K7FPT4
Sequence length 555
Comment (tr|K7FPT4|K7FPT4_PELSI) RAR related orphan receptor C {ECO:0000313|Ensembl:ENSPSIP00000010044} KW=Complete proteome; Reference proteome OX=13735 OS=Pelodiscus sinensis (Chinese softshell turtle) (Trionyx sinensis). GN=RORC OC=Pelodiscus.
Sequence
MPALLCQDIPSSAYCCNSGCFHYPPQGPAATAFAVELLASGRSCLSQIEVIPCKICGDKS
SGIHYGVITCEGCKGFFRRSQQGNVTYSCTRQQNCQIDRTSRNRCQHCRLQKCLSLGMSR
DGKMFRFWLENIEKWHQEKNFFLQKRVFGHEPFTLKAPTAGGEGASTPASSLGLANGQLK
LAPSPDLLESSACSTALLSGQARLSQSPDETAALAYPTGLAKGHSRLSDNLRGPFTREYS
PERIKMESRASVFYTLEMQASPDLARLDIGGGKRGQAGGDVGEAVDFYTSPNFTSILESP
NSSVTEIEHLTQNVLKSYRETCQLRLEDLQLLRLETFSWEEVRSYQKKSMEEMWERCACR
ITEAIQYVVEFAKRMGGFMELCQNDQIVLLKAGAMEVVLVRMCRAFNSENRTVFFEGKYA
GPELFKSLGCNELINSIFDFAHSLCSLHFSENEIALFTALVLINSSRPWLQEKDKVERLQ
NNLELAFKHMLRKTHRESILAKLPPKGKLRSLCYQHMEKLRSFRQMYPIIVHAVFPPLYK
ELFSSECELQGAAAE
Download sequence
Identical sequences K7FPT4
ENSPSIP00000010044 ENSPSIP00000010044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]