SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K7FUS8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K7FUS8
Domain Number 1 Region: 70-118
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000275
Family TSP-1 type 1 repeat 0.0055
Further Details:      
 
Domain Number 2 Region: 32-71
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000379
Family Somatomedin B domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K7FUS8
Sequence length 257
Comment (tr|K7FUS8|K7FUS8_PELSI) Uncharacterized protein {ECO:0000313|Ensembl:ENSPSIP00000011788} KW=Complete proteome; Reference proteome OX=13735 OS=Pelodiscus sinensis (Chinese softshell turtle) (Trionyx sinensis). GN= OC=Pelodiscus.
Sequence
WVAAALLLLLRAPGAETGWAEVGRCCRGRDLACVSTGWGPDRSHGACYCDQACARTMDCC
HDYPQACPEVPCAVSEWSNWSSCAEPCQATYRVRRRYVVQEPRNGGETCPPLEEKAGCVE
YWNQQGAECKQSLIPALITTGGYGKARKKRAASKENEGAGYCVEFQLMAITEGCLQGNSS
YTQWMRYLSKGHTVCVECQHPALDSKSLHCSGDGSGSKKNQLLHWQAMGNPWCRGTWRRV
RQLDTCSCPSVHSFLFI
Download sequence
Identical sequences K7FUS8
ENSPSIP00000011788 ENSPSIP00000011788

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]