SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K7FXE8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K7FXE8
Domain Number 1 Region: 14-242
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.52e-75
Family BAR domain 0.00000000284
Further Details:      
 
Domain Number 2 Region: 280-348
Classification Level Classification E-value
Superfamily SH3-domain 1.14e-22
Family SH3-domain 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K7FXE8
Sequence length 352
Comment (tr|K7FXE8|K7FXE8_PELSI) SH3 domain containing GRB2 like 2, endophilin A1 {ECO:0000313|Ensembl:ENSPSIP00000012708} KW=Complete proteome; Reference proteome OX=13735 OS=Pelodiscus sinensis (Chinese softshell turtle) (Trionyx sinensis). GN=SH3GL2 OC=Pelodiscus.
Sequence
MRNEDLPKPRHQSSQKVSEKVGGAEGTKLDDDFKEMERKVDVTSRAVVEIMTKTVEYLQP
NPASRAKLNMINTMSKIRGQEKGPGYPQAEALLADAMQKFGRELGDDCNFGPALGDVGEA
MRDLSEVKDSLDIEVKQNFIDPLQNLHDKDLREIQHHLKKMEGRRLDFDYKKKRQGRLPD
DELRQALEKFDESKEIAESSMFNLLEMDIEQVSQLSALVQAQLKYHRQATEILQQVTVKL
EERIRDASSQPRREYLPKPRMSLEFSSGENTQYNGGISQTGTPKPTGVPMDQPCCRALYD
FDPENEGELGFKEGDIITLTNQIDENWYEGMLHGQSGFFPINYVDILVPLPH
Download sequence
Identical sequences K7FXE8
ENSPSIP00000012708 ENSPSIP00000012708

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]