SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K7G0E4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K7G0E4
Domain Number 1 Region: 419-695
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.42e-78
Family Protein kinases, catalytic subunit 0.0000000352
Further Details:      
 
Domain Number 2 Region: 870-1010
Classification Level Classification E-value
Superfamily FAT domain of focal adhesion kinase 1.27e-57
Family FAT domain of focal adhesion kinase 0.00000464
Further Details:      
 
Domain Number 3 Region: 139-258
Classification Level Classification E-value
Superfamily Second domain of FERM 3.44e-40
Family Second domain of FERM 0.0000308
Further Details:      
 
Domain Number 4 Region: 38-138
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.34e-31
Family First domain of FERM 0.00036
Further Details:      
 
Domain Number 5 Region: 262-367
Classification Level Classification E-value
Superfamily PH domain-like 8.97e-30
Family Third domain of FERM 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K7G0E4
Sequence length 1014
Comment (tr|K7G0E4|K7G0E4_PELSI) Protein tyrosine kinase 2 beta {ECO:0000313|Ensembl:ENSPSIP00000013754} KW=Complete proteome; Reference proteome OX=13735 OS=Pelodiscus sinensis (Chinese softshell turtle) (Trionyx sinensis). GN=PTK2B OC=Pelodiscus.
Sequence
MSGMPEALTRLRGTSLRSLGGTLDPSMVSLPIDLEKEEMRILKVCFYSNSFNMGKNFKLV
KCSVLTEIREVINSILLSGRIGPDIQLAECYGLRLKHVKSDEIHWLHPELTVGEVQDKYE
CLHVEAEWRYDLQIRYLPEDYMESCREDRTTLLYFYQQLRSEYMQHYASKVSEGMALQLG
CLELRRFYKDMPHNALDKKSNFDLLEKEVGLDLFFPKQMQENLKPKQFRKMIQQTFQQYA
LLREEDCIIKFLNTLASFANIDQESYRCELIQGWNITVDLVIGPKGIRQMTSKEAKPTCL
AEFKQLKSIKCSSVEEGKAVLQLTLTGTPQSLAIKTSSLAEAENMADLIDGYCRMQGDKE
TSLIVRPKKENEKRVSLPQIPTQHIDERRPMLSESISVDSDIYAEIPDEASRPKSGAQQY
GISREDVTLGRILGEGFFGEVYEGIYTNQKGERTSVAVKTCKKDCTPENKEKFMSEAVLM
KKLDHPHIVKLIGITEEEPTWIVMELYPYGELGQYLEQNKNSLKVPTLILYALQIGKALA
YLEAISCVHRDIAVRNILVASSDCVKLGDFGLSRYIEDDEYYKASVTRLPIKWMSPESIN
FRRFTSASDVWMFAVCMWEILSYGKQPFFWLENKDVIGVLEKGDRLPKPDLCPPILYTLM
TRCWDYDPNDRPKFKELVCSLSDIYLTEKAIAKEQERNNRHRPPKIMEPMSFQEPPPKPS
RPKYKPPPQTNLLAPKLQFQVPEGLCASSPTLTSPIEYQSPVNSLHTPPLNRHNVFKRHS
MREEDFLRPASREEAQKLWEMERAKMRQMLEKQQKQMVEDYQWLRQEEKSLDPMVYLNNN
SPPLLPEKETDYTEFTGPPQKPPRLGAQPIQPTPTANLDRTDDTVYGNVMELVKAVLQLK
NEISQLPPEGYIIVVKNVGLSLRKLIGSVDEILPVLPAASRTEIEGTQKLLNKDLGELIN
KMRMAQQNAVTSLSEECKRQMLTASHTLAVDAKNLLDAVDQAKIQANLVKLSLE
Download sequence
Identical sequences K7G0E4
ENSPSIP00000013752 ENSPSIP00000013754 ENSPSIP00000013752 XP_014425792.1.96668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]