SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K7G0Y7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K7G0Y7
Domain Number 1 Region: 252-393
Classification Level Classification E-value
Superfamily PapD-like 3.4e-39
Family MSP-like 0.000000683
Further Details:      
 
Domain Number 2 Region: 24-187
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 2.62e-37
Family CRAL/TRIO domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K7G0Y7
Sequence length 456
Comment (tr|K7G0Y7|K7G0Y7_PELSI) Motile sperm domain containing 2 {ECO:0000313|Ensembl:ENSPSIP00000013947} KW=Complete proteome; Reference proteome OX=13735 OS=Pelodiscus sinensis (Chinese softshell turtle) (Trionyx sinensis). GN=MOSPD2 OC=Pelodiscus.
Sequence
MIDESFQWRKEYTVNDLSESVLPKWLFENGALYLHGYDKEGYKLFWFRVKFHTKDPKVQF
EKKKFVAFWLEHYARREHGKPLTVVFDMAETGVSHIDLDFIRFIVHCFKVYYPNYLSKIV
IFEMPWIMNAAFKIVKGWLGPDAISMLKFTNKNEIQEYISAEYLPGYMGGIDTFKYSYPP
LVDDDFQTPLCENGPIASEDEIESKEEIEADSKEARECSEEQVLNSKKVCSVEQISKPEE
NDKTDSKTKNSKKALTVFKGLLLHISPSEELFFGSKETGEKKCLIVLTNVTKNVVAFKVR
TTAPDKYRVKPSNSSCEPGTSIDIVVSLHGGFTASLQDRFLIMAAEMDQSSGAGVPELAQ
FWKEVPRNKVMEHRLRCHVVESSKPSTLSLKENSFNMPTKTNEDLHLQLTQLLQVNKKLQ
EQIDYCVWFQQLIVVLALVLVVIAAFCFYLLYTQRC
Download sequence
Identical sequences K7G0Y7
XP_006122878.1.96668 ENSPSIP00000013947 ENSPSIP00000013947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]