SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K7G5B7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K7G5B7
Domain Number 1 Region: 568-815
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 8.26e-57
Family Nuclear receptor ligand-binding domain 0.00000000118
Further Details:      
 
Domain Number 2 Region: 445-523
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 7.54e-24
Family Nuclear receptor 0.0000286
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K7G5B7
Sequence length 817
Comment (tr|K7G5B7|K7G5B7_PELSI) Progesterone receptor {ECO:0000313|Ensembl:ENSPSIP00000015478} KW=Complete proteome; Reference proteome OX=13735 OS=Pelodiscus sinensis (Chinese softshell turtle) (Trionyx sinensis). GN=PGR OC=Pelodiscus.
Sequence
MSGMKATDSRAPGCAADSSVRLQGPERDPFRGGAGTVDISLHGLLYPKSSEEEEEEEEQR
ERLEREERGPSSQLAGGGSPAERDALDSVLDTFLAPPAHASSAGAPQNWCLFGVGIPEIP
NALMSHRSEQQRGEAAAAGHRSSPAAIPGPLPPPDPPASLWPGEGPPAAASKLPPQLEDK
GAAESTDGQCSGPAALSEEDHGFASGGAAEQDAGSGSSLALAPAHAAVPGQDFLHVPILP
LNSAYLAARTRQLLDVEEYGSSCLDRRVSPTSAPRDFADYGYPQPLSKEEHYSYGDFQPA
LKIKEEGISAAAAPYLGTKTTPAAVCPAEYTLAPPQPRASQEPSSLECILYKTESPALAG
SYGPPHCKASGSTSCMVQRDSLPSTSTAPQALYQPLNLNGHQQLGFQTAMLKDSLPPIYP
AYLNYIRPDTDVGQSPQYSFESLPQKICLICGDEASGCHYGVLTCGSCKVFFKRAMEGQH
NYLCAGRNDCIVDKIRRKNCPACRLRKCCQAGMVLGGRKFKKFNKVKVMRTLDIVALQQP
VTLPDESHAVTQRVSFSPNQEIPFVPSLITILQGIEPEVVYAGYDNTRPETPSALLTSLN
QLCERQLLCVVKWSKSLPGFRNLHIDDQITLIQYSWMSLMVFAMGWRSYKHVSGQMLYFA
PDLILNEGVRQRMKESSFYSLCLSMWQIPQELVKLQVSQEEFLCMKSLLLLSTIPLEGLR
SQSQFDEMRASYIRELVKAVGLRQKGVVASSQRFYQLTKFMDSLHDLVKQLHLFCLNTFL
QSRALSVEFPEMMSEVIAAQLPKILAGMVKPLLFHKK
Download sequence
Identical sequences K7G5B7
ENSPSIP00000015478 ENSPSIP00000015478

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]