SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K7G5W0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K7G5W0
Domain Number 1 Region: 190-314
Classification Level Classification E-value
Superfamily PH domain-like 4.51e-40
Family Third domain of FERM 0.00000046
Further Details:      
 
Domain Number 2 Region: 82-189
Classification Level Classification E-value
Superfamily Second domain of FERM 7.07e-38
Family Second domain of FERM 0.000000716
Further Details:      
 
Domain Number 3 Region: 11-78
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.06e-21
Family First domain of FERM 0.0000238
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K7G5W0
Sequence length 328
Comment (tr|K7G5W0|K7G5W0_PELSI) Neurofibromin 2 {ECO:0000313|Ensembl:ENSPSIP00000015671} KW=Complete proteome; Reference proteome OX=13735 OS=Pelodiscus sinensis (Chinese softshell turtle) (Trionyx sinensis). GN=NF2 OC=Pelodiscus.
Sequence
MSPLHPHKANICEVKWKGKDLFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDKKVLDHD
VPTEEPVTFHFLAKFYPENAEEELVQEITQHLFFLQVKKQILDEKIYCPPEASVLLASYA
VQAKYGDYDPSVHQRGFLAQEELLPKRVINLYQMTPEMWEERITAWYAEHRGRARDEAEM
EYLKIAQDLEMYGVNYFAIRNKKGTELLLGVDALGLHIYDPENRLSPKISFPWNEIRNIS
YSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLCIGNHDLFMRRRKADSLEVQQMKAQA
REEKARKQMERQRLGRGGETSWSGGCCS
Download sequence
Identical sequences K7G5W0
ENSPSIP00000015671 ENSPSIP00000015671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]