SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K7GGE4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K7GGE4
Domain Number 1 Region: 216-230,415-629
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.88e-63
Family Nuclear receptor ligand-binding domain 0.0000566
Further Details:      
 
Domain Number 2 Region: 148-229
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.46e-29
Family Nuclear receptor 0.000099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K7GGE4
Sequence length 641
Comment (tr|K7GGE4|K7GGE4_PELSI) Nuclear receptor subfamily 2 group C member 1 {ECO:0000313|Ensembl:ENSPSIP00000019355} KW=Complete proteome; Reference proteome OX=13735 OS=Pelodiscus sinensis (Chinese softshell turtle) (Trionyx sinensis). GN=NR2C1 OC=Pelodiscus.
Sequence
MATIEELAHQIIEQQMGEIAHSQGTITQTLMDGTAQRIQIVPADSGLSLPQRIQIVTDQQ
TGQKIQIVTALDQNTAGKQFILTNHDGSTPSKVILARQDSTPGKVFLTTPDAAGVNQLFF
ASPDLSAQHIQILTDNTSTEQSLNKVFDLCVVCGDKASGRHYGAVTCEGCKGFFKRSIRK
NLVYSCRGAKDCVINKHHRNRCQYCRLQRCIAFGMKQDSVQCERKPIEVSREKSSNCAAS
TEKIYIRKDLRSPLAATPTFVTDNETARSTGLLESGMFVNIHQSGIKSEPTVLMTQDKVE
ACQGDLSTLANVVTSLASLSKSKDMSQSSAELSMIESLSNGDTSLSELHQEEQASSDVTR
AFDTLAKALNPGESAACQSSAESIEANVHLIGGETSMNIVEIEGPLLSDAHVAFRLTMPS
PMPEYLNVHYICESASRLLFLSMHWARSIPSFQALGQDNSISLVKACWNELFTLGLAQCS
QVMNVATILTAFVNHLHGSLQQDKLSTDRGKLVMEHIFKLQEFCNSMVKLCLDGYEYAYL
KAIVLFSPDHPGLENVIQIEKFQEKAYMEFQDYVTKAYPDDTYRLSRLLLRLPALRLMSA
NITEELFFAGLIGNVQIDSIIPYILRMETADYNSQIIGHSV
Download sequence
Identical sequences K7GGE4
ENSPSIP00000019355 ENSPSIP00000019355 XP_006118365.1.96668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]