SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K7GJ00 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K7GJ00
Domain Number 1 Region: 199-343
Classification Level Classification E-value
Superfamily PH domain-like 2.95e-45
Family Third domain of FERM 0.000000226
Further Details:      
 
Domain Number 2 Region: 89-198
Classification Level Classification E-value
Superfamily Second domain of FERM 8.11e-38
Family Second domain of FERM 0.00000104
Further Details:      
 
Domain Number 3 Region: 499-587
Classification Level Classification E-value
Superfamily Moesin tail domain 3.01e-32
Family Moesin tail domain 0.0000229
Further Details:      
 
Domain Number 4 Region: 2-87
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.07e-26
Family First domain of FERM 0.0000101
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K7GJ00
Sequence length 587
Comment (tr|K7GJ00|K7GJ00_PELSI) Ezrin {ECO:0000313|Ensembl:ENSPSIP00000020261} KW=Complete proteome; Reference proteome OX=13735 OS=Pelodiscus sinensis (Chinese softshell turtle) (Trionyx sinensis). GN=EZR OC=Pelodiscus.
Sequence
MPKPLNVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYFGLQYTDNKGFLTWLK
LDKKVSAQEVKKENPLQFKFRAKFFPEDVSEELIQDITQKLFFLQVKEGILSDEIYCPPE
TAVLLGSYAVQAKFGDYNKEAHKPGYLNSERLIPQRVMDQHKLSREQWEERIEVWHAEHG
GMLKENAMLEYLKIAQDLEMYGINYFEIKNKKGTDLWLGVDALGLNIYEKDDKLTPKIGF
PWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILQLCMGNHELYMRRRKPDTI
EVQQMKAQAREEKHQKQMERQQLENEKKKRETIEREKEQMLREKEELMVRLQEYEIKTRK
AEKELSDQVQKALQLEEERRRAEKEAERLETERLAALQAKEELEKQTVDQMKSQEQLAAE
LAEYTAKIALLEEARKRKENEVEEWQHRAKEAQDDLVKTKEELHLVMTAPPPPPPAPVYE
PVNYHVHDNLHDEGTEYSGYSAEFSSEGILGDRNEEKRITEAEKNQRVQRQLMTLTDELA
QARDENKKTHNDMIHTENMRQGRDKYKTLRQIRQGNTKQRIDEFEAM
Download sequence
Identical sequences K7GJ00
ENSPSIP00000020261 XP_006115060.1.96668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]