SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K7GJL2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K7GJL2
Domain Number 1 Region: 149-442
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.29e-82
Family Nuclear receptor ligand-binding domain 0.000000015
Further Details:      
 
Domain Number 2 Region: 46-133
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.04e-28
Family Nuclear receptor 0.0000085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K7GJL2
Sequence length 447
Comment (tr|K7GJL2|K7GJL2_PELSI) Vitamin D receptor {ECO:0000313|Ensembl:ENSPSIP00000020473} KW=Complete proteome; Reference proteome OX=13735 OS=Pelodiscus sinensis (Chinese softshell turtle) (Trionyx sinensis). GN=VDR OC=Pelodiscus.
Sequence
MSQLQDCWEFYQDGAAHVLDAVSEMELLEASTPLPDPASEFDRNVPRICGVCGDKATGFH
FNAMTCEGCKGFFRRSMKRKAMFTCPFNSDCKITKDNRRHCQACRLKRCVDIGMMKEFIL
TDEEVQRKRELITRRKEEEALKESMKPKLSEEQQRVIDVLLEAHRKTYDPTYSDFTQFRP
PVRASASNRMATRSSSVLTHGSSSEDSSDTFSSSPVSTLSPPESFEHRMFSSMALSEDSD
ASPSMDMSLSHLSMLPHLADLVSYSIQKVIGFAKMIPGFRDLMAEDQIALLKSSAIEIIM
LRSNQSFSLEDMAWSCGGNEFKYQVTDVTQAGHSLELLEPLVKFQIALKKLSLHEEEHVL
LMGICILSPDRPGVQDTALVEVLQTYILCKHPPPGNRLLYAKMIQKLADLRSLNEEHSKQ
YRCLSFKPEHSMQLTPLGLEVFGNEIS
Download sequence
Identical sequences K7GJL2
ENSPSIP00000020473 ENSPSIP00000020473

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]