SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K7GJX0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K7GJX0
Domain Number 1 Region: 222-235,277-524
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.2e-62
Family Nuclear receptor ligand-binding domain 0.00000000341
Further Details:      
 
Domain Number 2 Region: 171-250
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.34e-25
Family Nuclear receptor 0.0000235
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K7GJX0
Sequence length 556
Comment (tr|K7GJX0|K7GJX0_PELSI) Estrogen receptor 2 {ECO:0000313|Ensembl:ENSPSIP00000020581} KW=Complete proteome; Reference proteome OX=13735 OS=Pelodiscus sinensis (Chinese softshell turtle) (Trionyx sinensis). GN=ESR2 OC=Pelodiscus.
Sequence
MSMCASSHKEFSQLLPIQDIGRSKTEIKSSPSGINSPVYSCSQSVLTMEQSPIYIPSSYV
ENRHEYSAMAFYSPTMMNYNIPSNFSDSESASVRQTSSPNVLWSAPGHISPLTLHSQPSL
LYAEQPKSPWCETRPVDHALPMNRETLKRKPNGSDFTSPAVNSPGSKRDAHFCAVCSDYA
SGYHYGVWSCEGCKAFFKRSIQGHNDYICPATNQCTIDKNRRKSCQACRLRKCCEVGMMK
CGSRRDRCGYRIIRRHRNSEDQAHCSGKAKKNSENATRVKEILLSALNPEQFVLTLLEAE
PPNVLLVSRPNKPFTEASMMMSLTKLADKELVHMIGWAKKIPGFIELSLYDQVRLLESCW
MEVLMMGLMWRSIDYPGKLIFAPDLVLDRDEGKCVEGILEIFDMLLATTSRFRELKLQHK
EYLCVKAMILLNSSMFSLSAATEEPESNRKLHHLLNTVIDALVWVISKSGIPSQQQTTRM
ANLLMLLSHVRHASNKGMEHLLSMKCKNVVPVYDLLLEMLNAHTLRGQRKSAVTDSDYVP
AEQTDTRGSTWNMAAQ
Download sequence
Identical sequences K7GJX0
ENSPSIP00000020581 XP_006134140.1.96668 ENSPSIP00000020581

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]