SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K7H777 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K7H777
Domain Number 1 Region: 171-298
Classification Level Classification E-value
Superfamily PapD-like 4.97e-23
Family MSP-like 0.0036
Further Details:      
 
Domain Number 2 Region: 1-87
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.0000000693
Family CRAL/TRIO domain 0.012
Further Details:      
 
Weak hits

Sequence:  K7H777
Domain Number - Region: 90-147
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.034
Family Formin homology 2 domain (FH2 domain) 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K7H777
Sequence length 385
Comment (tr|K7H777|K7H777_CAEJA) Major sperm protein {ECO:0000256|RuleBase:RU003425} KW=Complete proteome; Reference proteome OX=281687 OS=Caenorhabditis japonica. GN= OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MKFIIHSNKYYYPNAIESILIFENPAILNASWKVIGSWLESSAASQRHGLLTFVTKLSVT
HYVSKSHLLEHQGGTDTFKFTMDELAKCLPPPPPPKPSPKLLQQQRNSIDDTVNNNVSEF
DFSSFHKRNVKFDEESSVKRAPSLLSRRSSRGPTNRKSHIPPSLRPLIETRVNAPNDDWS
SNDFVSITPRDELRLEKLDGENDLLDVVLVKNQSSDTPIMFKFKTTSPEKFRVRPSSGIV
QPGTTEIIKVYLQYEYRHSWSKEKFLLLTMESSSTDIDSFSDQFKTAVKKAEFKFKCRLS
DSVKLDQPEERRSSFLLQQQQQQKVEQRGININMPIIILFLFLLLLFQFFYIIQVRSDNS
ILRETLITLSSQLKENSVEAVKNEL
Download sequence
Identical sequences K7H777

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]