SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K7J2Y6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K7J2Y6
Domain Number 1 Region: 10-167
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.31e-46
Family Calponin-homology domain, CH-domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K7J2Y6
Sequence length 184
Comment (tr|K7J2Y6|K7J2Y6_NASVI) Transgelin {ECO:0000256|RuleBase:RU361224} KW=Complete proteome; Reference proteome OX=7425 OS=Nasonia vitripennis (Parasitic wasp). GN=LOC100117880 OC=Chalcidoidea; Pteromalidae; Pteromalinae; Nasonia.
Sequence
MALERQVHAKILAKRDPEQEREAQEWIESIIGNKFPAGLPIEDVLKDGVVLCELMNKIKP
GSINKVNTSGGEFKMMENINKFQKALKEYGVSDVDVFQTVDLWEKKNIAQVVTTLFALGR
ETYRHPEFQGPNLGPKPADECKRDFSEEQLKAGQTVIGLQAGSNKGATQAGQNMGASRKI
LLGK
Download sequence
Identical sequences K7J2Y6
XP_001607748.1.61660 gi|156551940|ref|XP_001607748.1| 7425.XP_001607748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]