SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K7U3E7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K7U3E7
Domain Number 1 Region: 479-775
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.93e-74
Family Protein kinases, catalytic subunit 0.00036
Further Details:      
 
Domain Number 2 Region: 67-161,193-225
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.24e-29
Family alpha-D-mannose-specific plant lectins 0.003
Further Details:      
 
Weak hits

Sequence:  K7U3E7
Domain Number - Region: 355-411
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00746
Family Pan module (APPLE domain) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K7U3E7
Sequence length 797
Comment (tr|K7U3E7|K7U3E7_MAIZE) Serine/threonine-protein kinase {ECO:0000313|EMBL:AQK43649.1} KW=Complete proteome; Reference proteome OX=4577 OS=Zea mays (Maize). GN=ZEAMMB73_Zm00001d025388 OC=Zea.
Sequence
MHLLAVLCGVIFSLLQLHTPTRSAATDTLSRGGSLAGDETLVSSNGKFALGFFETKSDNS
THNASNSYLGIWFHKVPRLTPVWSANGDNPVSSTASPELMISDDGNLVIIAATGTKVWST
QANITANISVVAVLLADGNLVLRSSTNSSDVFWQSFDHPTDTLLPGAKLGRNKATGLDRR
FVSRRNSNDQAPGVYSIGLAPDGVDESMRLSWRSSTEYWSSGEWNGRYFNGIPEMSDPSY
CNYMFVSSGPEFYFSYTLVNESTAFQVVLDVSGQWMVRVWDWDRNDWITFSYSPRSKCDV
YAVCGAYAVCSSNADPVCSCMKGFSVRSPEDWEMEDRTGGCIRDTPLDCNATSMADRFYP
MPFSRLPSNGMGIQNATSAKSCEGSCLSSCSCTAYSYGQGGCSLWHDDLTNVAPDDTGET
LYLRLAAKEVQSWKHHRHGMVIGVAVGVSAVTATLVFIFLIWRRSSRRSSHPADSDQGGI
GIIAFRYADIKRATNNFTEKLGTGGFGSVFKGCLGESVAIAVKRLDGAHQGEKQFRSEVS
SIGIIQHVNLVKLVGFCCEGDRRLLVYEHMPNRSLDVHLFHQSAHGSGTTGLRWDIRYQI
ALGVARGLAYLHHSCQDCIIHCDIKPQNILLDASFVPKIADFGMAKFLGRDFSRVLTTMR
GTVGYLAPEWISGTAITSKVDVYSYGMVLLEIVSGRRNAGREASTDDDCCHAKCCFPVQV
VDKLLNGGVESVVDASLGGDVNLDDVERVCRVACWCVQDNEYDRPTMVEVVQFLEGLSEP
DMPPMPRLLHAIAGGSP
Download sequence
Identical sequences K7U3E7
GRMZM2G471596_T01|PACid:20873256 XP_008664164.1.34533 GRMZM2G471596_P01

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]