SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K7UC64 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K7UC64
Domain Number 1 Region: 485-775
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.24e-74
Family Protein kinases, catalytic subunit 0.00021
Further Details:      
 
Domain Number 2 Region: 66-160,192-210
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.57e-29
Family alpha-D-mannose-specific plant lectins 0.0026
Further Details:      
 
Weak hits

Sequence:  K7UC64
Domain Number - Region: 353-413
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0108
Family Pan module (APPLE domain) 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K7UC64
Sequence length 814
Comment (tr|K7UC64|K7UC64_MAIZE) Serine/threonine-protein kinase {ECO:0000313|EMBL:AQK39493.1} KW=Complete proteome; Reference proteome OX=4577 OS=Zea mays (Maize). GN=ZEAMMB73_Zm00001d023524 OC=Zea.
Sequence
MLLLQVILLGLLSLHAPSNSATATDTVSPGNGLAGSSRLVSNNSKFALGFFRMDSKSFNY
ATNPYTYLGIWFNKVPKLTPLWSANGESPVMDPASPELAIAGDGNLVILDQATRSVIWST
HANTTTNDTVAVLQNNGNLVLRSSSNSSTVFWQSFDYPTDTFFAGAKIGWDKVTGLNRRL
VSRKNLIDQAPGLYTGEIQKNGVGHLVWNSTVEIESTGLWNGQYFSSAPEMIGNTVSITT
FEYVNNDKEVYFTWNLQDETAIVLSQLGVDGQGMVSLWIDKDWVVMYKQPVLQCDAYATC
GPFTVCDEGENEGPICNCMKGFSVSSPRDWELGDRRDGCTRNTPLHCGRSRNTDKFYAPQ
NVMLPQDAMKMQAATSDEDDCSRACLGNCSCTGYSYGEGGCSVWHGKLTNVKKQQPDGNG
ETLYLRLAAKEVPGVPRKNSRIFRFGAAIIGASAAAVAALMILGLMMTWRRKGKLFTRTV
GDAQVGIGITTFRYVDLQHATKNFSEKLGGGSFGSVFKGYLSDSLALAVKRLDGANQGEK
QFRAEVSSVGIIQHINLVKLIGFCCQGDQRLLVYEYMPNHSLDAHLFKVGSDTVLEWNLR
YQIAIGVARGLAYLHTGCRDCIIHCDIKPENILLDASFVPKIADFGMAKVLGREFSDAIT
TMRGTIGYLAPEWISGEAVTSKVDVYSYGSVLFEIVSGRRNSSQEYSKDGDYSAFFPVQV
ARKLLSGDIGSLVDASLHGNVNLEEVERVCKVACWCIQDSEFDRPTMTEVVQFLEGVSEL
HMPPVPRLLDAITGGATNTKIYSMLSVEGSPTSV
Download sequence
Identical sequences K7UC64
GRMZM2G301124_T01|PACid:20874668 GRMZM2G301124_P01

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]