SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K7W7V5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  K7W7V5
Domain Number - Region: 129-164
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0235
Family Type I dockerin domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K7W7V5
Sequence length 165
Comment (tr|K7W7V5|K7W7V5_9NOST) Uncharacterized protein {ECO:0000313|EMBL:AFW97052.1} KW=Complete proteome; Reference proteome OX=46234 OS=Anabaena sp. 90. GN=ANA_C20624 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Anabaena.
Sequence
MGLFDQILGAVSNSNQPGGLDNLINIATTVKQLGNGIGADSSTMQSVLSVVGKQVQSSLQ
AKQTSDGSESVQDLVNQFAGTSANSQAVDTLFSPDIQAEVAENAAQGTSLDVNTIQQLLP
SLVPLVLSFLQSGGNPLLNQFLDADGDGDVDIADAIKLASRFLRI
Download sequence
Identical sequences K7W7V5
gi|414079685|ref|YP_007001109.1| WP_015083605.1.50365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]