SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K8E8R2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K8E8R2
Domain Number 1 Region: 80-156
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.29e-17
Family Glutathione S-transferase (GST), N-terminal domain 0.0086
Further Details:      
 
Domain Number 2 Region: 173-278
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.0000000000223
Family Glutathione S-transferase (GST), C-terminal domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K8E8R2
Sequence length 465
Comment (tr|K8E8R2|K8E8R2_9CHLO) Glutathione S-transferase {ECO:0000313|EMBL:CCO13991.1} KW=Complete proteome; Reference proteome OX=41875 OS=Bathycoccus prasinos. GN=Bathy01g00030 OC=Mamiellales; Bathycoccaceae; Bathycoccus.
Sequence
MSSTSSKKKRITNATVVEVDGSNAPSWKDLERIATDLKKKHDIPETIDLEAGPTSPKCLK
RTFGKTDEEIRVHFYRDHAGWCPYCETVWLLLEEKRIPYTVEKINMRCYGDKPQSFLKNV
PSGMLPVVVIDGVLMTESAVIQEALETKFSDVASYPAMLPPNESSEAQTLFRLERKLFSN
WMQWLTGNWNDAASRATFCETLDEVDLRLSETVDSPYFLNSGFSLVDIKFAPFLERMAAS
LLYYKGLRIEGSKRWPHIDNWFANMSNRPTFRMIRSDYFTHVHDLPPQLGGCVENNTQEQ
IDAMSAINGRDGKSWQLPLPPLNESSLEPLWEKENPERDRLEAAIQLLSNYENVSRFACR
GASATPSKKRVSAPLSDPFATPNEDYVEAVDVALRTVAAMLLRTDNSDIPQGCENVLGTN
ASQVTKKNVSLSLEYLRDRVGVPRDMRMPAARQLRSHLNFAISHL
Download sequence
Identical sequences K8E8R2
XP_007515112.1.44737 Bathy01g00030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]