SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K8E995 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K8E995
Domain Number 1 Region: 173-297
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 6.82e-19
Family Glutathione S-transferase (GST), C-terminal domain 0.014
Further Details:      
 
Domain Number 2 Region: 93-177
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000000608
Family Glutathione S-transferase (GST), N-terminal domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K8E995
Sequence length 334
Comment (tr|K8E995|K8E995_9CHLO) Glutathione s-transferase {ECO:0000313|EMBL:CCO14179.1} KW=Complete proteome; Reference proteome OX=41875 OS=Bathycoccus prasinos. GN=Bathy01g06230 OC=Mamiellales; Bathycoccaceae; Bathycoccus.
Sequence
MMMQTIHTQRYQSGNSATSSSSSKKSTKQQPSSSSFRLCGSGGAAALRKSGFNGGEKMNK
RRRGRCALMSAAESSSEETTGDFEAALDPVYKNIFYDVPVSNNGARNRLIICWKNIEDEF
EFKNPSTLGGLKSPEFLEMHPQGKMPLLVTKDGQAIPESEVISQYLCDAFEKQGPSLRPE
TLEAKTACNLATRWHDVYLTPIQGCMYRGPMSPEVRAEQISEIDRLLDVMEKTVGGFEPG
PYLCGDKPSTADAALFPTFVFMTHLLPKYFGWENVFDGRPSLERWYKHMSTEDACAKKIK
MEVMGGLMAWDESDRYEKNGLVAAVANDSFQWSY
Download sequence
Identical sequences K8E995
XP_007515300.1.44737 Bathy01g06230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]