SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K8EH16 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K8EH16
Domain Number 1 Region: 2-103
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.74e-25
Family Thioltransferase 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K8EH16
Sequence length 105
Comment (tr|K8EH16|K8EH16_9CHLO) Thioredoxin {ECO:0000256|PIRNR:PIRNR000077} KW=Complete proteome; Reference proteome OX=41875 OS=Bathycoccus prasinos. GN=Bathy06g04960 OC=Mamiellales; Bathycoccaceae; Bathycoccus.
Sequence
MNAEQLEVAMADRSTPLVIDFYATWCGPCVLMSAELEKVKEQLGEAVRCIKVDTDEETEL
ATQLGIEGLPTIVFVSKDAASPALRTEGMIPAETVISIIENQLQG
Download sequence
Identical sequences K8EH16
XP_007512726.1.44737 Bathy06g04960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]