SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K8EHQ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K8EHQ3
Domain Number 1 Region: 131-271
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.00000000000000185
Family Glutathione S-transferase (GST), C-terminal domain 0.0022
Further Details:      
 
Domain Number 2 Region: 23-118
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000209
Family Glutathione S-transferase (GST), N-terminal domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K8EHQ3
Sequence length 285
Comment (tr|K8EHQ3|K8EHQ3_9CHLO) Glutathione-s-transferase (ISS) {ECO:0000313|EMBL:CCO17534.1} KW=Complete proteome; Reference proteome OX=41875 OS=Bathycoccus prasinos. GN=Bathy08g02690 OC=Mamiellales; Bathycoccaceae; Bathycoccus.
Sequence
MTPPQPKWKSETAEEETGEGQQPRFTMGYWQMRGLGAAIRMLLHWGKYTHRGGAEMNFKD
VQYAQDANGVNEWFKRDKVEMIKDANPLANIPYLIDHEEKKTIVQFLCICDYLGRKIGVD
ETDENSDQRLRNAQIAMEIFDLRNSVIRLVYKFPNSVRTQSEFYERLPEHLGACKKTYKK
LESWLQFHDFTYFAKKDAVSSCDFHAFEMIDQHEHYQTLVREKDGEAVEKQGMLSEFPRL
KKFHAEMKSRPELKAYFESKEYKEFQLNNHTLANSWDGPGPSSKR
Download sequence
Identical sequences K8EHQ3
XP_007511413.1.44737 Bathy08g02690

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]