SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K8ENN5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K8ENN5
Domain Number 1 Region: 26-218
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.51e-29
Family Phosducin 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K8ENN5
Sequence length 249
Comment (tr|K8ENN5|K8ENN5_9CHLO) Phosducin-like protein 3 {ECO:0000313|EMBL:CCO19574.1} KW=Complete proteome; Reference proteome OX=41875 OS=Bathycoccus prasinos. GN=Bathy14g00310 OC=Mamiellales; Bathycoccaceae; Bathycoccus.
Sequence
MKTLTKQTTTTEWDEVLQKKFGNNFVKEDKVKEDEQRKGTPRTMKKEETNVAIFENERDD
ENDENDEDEEEEAFMKSYREKRIAEMLFMQKEEKEDEKEEKNNNVRRNEYVMHVSHEQWT
KEVTEVSRSHPVLVLLTKENSKACFTLERVMEDVARTYRTSRTKFRRAEARDIIPNYPER
NVPTLILYRNGDVVENIVGIEQFGGMSGVNTETVRRRVRMKSDEFLMDRGEEEAKEAEKR
REKETAKNG
Download sequence
Identical sequences K8ENN5
XP_007509117.1.44737 Bathy14g00310

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]