SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K8EP82 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K8EP82
Domain Number 1 Region: 1-72
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000000587
Family PDI-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K8EP82
Sequence length 164
Comment (tr|K8EP82|K8EP82_9CHLO) Uncharacterized protein {ECO:0000313|EMBL:CCO14255.1} KW=Complete proteome; Reference proteome OX=41875 OS=Bathycoccus prasinos. GN=Bathy01g00590 OC=Mamiellales; Bathycoccaceae; Bathycoccus.
Sequence
MKPAWDKLGSKYKDHASVMIVDVDCTADGAQTCQKMGVQGYPTIKYFLAGDKKGKDYQQG
RDFDAMLAFTKKTLDVEKCDVKTKKACKPNEIALIEKFDGKTSADIAEELKKRSEELKTI
KSDMKAAKLEHNTKVATWKKREAALNKGEAILKQLEQLRKKDEL
Download sequence
Identical sequences K8EP82
Bathy01g00590 MES00004638958 XP_007515376.1.44737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]