SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K8EYD3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K8EYD3
Domain Number 1 Region: 116-202
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.55e-22
Family PDI-like 0.013
Further Details:      
 
Domain Number 2 Region: 14-69
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000642
Family Thioltransferase 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) K8EYD3
Sequence length 297
Comment (tr|K8EYD3|K8EYD3_9CHLO) Uncharacterized protein {ECO:0000313|EMBL:CCO17495.1} KW=Complete proteome; Reference proteome OX=41875 OS=Bathycoccus prasinos. GN=Bathy08g02420 OC=Mamiellales; Bathycoccaceae; Bathycoccus.
Sequence
MFGMKKSLTFVGLLAITGANAGAVDLTEGDFDAQVFESGKGAFVKFYAPWGGTNQRSRGV
TLQASRRRENWSIRSSLSKKKKSRRGEQRRACFCHFLVRRSFRILSYRYYLFIIIIIIIV
TNRCGHCKALKPAWDKLGDEYDGSSTVLIGDVDCTVHQNLCQKYGVQGYPTLKYFTANPM
GDAYNGGRDYEELSKFAKESLGPSCGVEHMDLCDAEQKKSLETKMALSDSELDKLIEDSD
AKLKQADEDLEALLKGLQQQYEDGKKAKEDAQAALSPELAQLRSVKRSRENGAKQEL
Download sequence
Identical sequences K8EYD3
XP_007511374.1.44737 Bathy08g02420

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]