SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K8F086 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K8F086
Domain Number 1 Region: 91-221
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.00000000000278
Family Glutathione S-transferase (GST), C-terminal domain 0.0036
Further Details:      
 
Domain Number 2 Region: 19-85
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000391
Family Glutathione S-transferase (GST), N-terminal domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) K8F086
Sequence length 263
Comment (tr|K8F086|K8F086_9CHLO) Uncharacterized protein {ECO:0000313|EMBL:CCO18200.1} KW=Complete proteome; Reference proteome OX=41875 OS=Bathycoccus prasinos. GN=Bathy10g01080 OC=Mamiellales; Bathycoccaceae; Bathycoccus.
Sequence
MHCTRISLSLRHSRNATVYMYRIVNLPVKIELVKLHKREHKSEPFLRVNKFGQVPALCVE
RQKGQVKFVLSESSAILKYLSEKYPSIVSESKMYSDDLREKAKIWSALDWYQTTIRSSAA
GVSWHAFVAGNMGGKVSLELAKHYEERLKMSLDVLETLRLGDTFPFLNEREHPSIADLLV
IEDIVNLVVLKGSPFREELSSLDQLLAERPRVRKWRDAVMRINKPLWDEIHGVLEMVAEN
ASKKIDSESRRRRFDDVASMSRL
Download sequence
Identical sequences K8F086
XP_007510667.1.44737 Bathy10g01080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]