SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K8F5G7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K8F5G7
Domain Number 1 Region: 114-285
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.47e-41
Family Glutathione peroxidase-like 0.00000866
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K8F5G7
Sequence length 294
Comment (tr|K8F5G7|K8F5G7_9CHLO) Uncharacterized protein {ECO:0000313|EMBL:CCO20060.1} KW=Complete proteome; Reference proteome OX=41875 OS=Bathycoccus prasinos. GN=Bathy15g00070 OC=Mamiellales; Bathycoccaceae; Bathycoccus.
Sequence
MVMSMRRLFAASLERRCASTSTTTHKSFTSPPPSFFLRRRHHSHKQQHDQYLRRMMYSTT
SGSGSNNNNSPVGWKSLLLLVLTGSGVLFFFENEKKRRMKSIAENQKGVGKAAVGGPFEL
INAATNKKFTDKDLLGNFCLIYFGFTTCPDICPDELEKMSEVIDIVEKETEKKDNSSNTP
SSANKIPPLVPVFISIDPERDTTKVVKEYVKEFHPKLIGLTGSKEQCAKAARAYRVYYHK
TNESSKDYLVDHSIIMYLIDKRGDFVAFYGKNYEARPMAMNILEHISSVSNDQK
Download sequence
Identical sequences K8F5G7
Bathy15g00070 XP_007508974.1.44737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]