SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K8FE64 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K8FE64
Domain Number 1 Region: 4-137
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.2e-32
Family spliceosomal protein U5-15Kd 0.00000113
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) K8FE64
Sequence length 142
Comment (tr|K8FE64|K8FE64_9CHLO) Uncharacterized protein {ECO:0000313|EMBL:CCO65971.1} KW=Complete proteome; Reference proteome OX=41875 OS=Bathycoccus prasinos. GN=Bathy07g02740 OC=Mamiellales; Bathycoccaceae; Bathycoccus.
Sequence
MSYLLPHLHTGWHVDQAILSEEDRVVILRFGRDGDETCMRQDEILSNVAEKIKNFAVAYL
VDIDEVPDFNEMYELYDPCTCMFFFRNKHIMIDLGTGNNNKINWAMDSKQEFIDIVECVF
SGARRGKGLVISPKDYSTKYRY
Download sequence
Identical sequences K8FE64
Bathy07g02740 XP_007511883.1.44737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]